Commercial Costs For Mouse Monoclonal Antibody Development

Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Description: A sandwich ELISA kit for quantitative measurement of Rat EED (Embryonic Ectoderm Development) in samples from Serum, Plasma, Cell supernatant

Description: _The Influenza A H1N1 HA ELISA development kit is for the quantitative determination of Influenza A H1N1 (A/California/04/2009) Hemagglutinin. _This ELISA Pair Set contains the basic components required for the development of sandwich ELISAs.

Description: For the development of sandwich ELISAs to measure natural and recombinant mouse S100 Calcium Binding Protein A8 and S100 Calcium Binding Protein A9 Heterodimer (S100A8/S100A9 Heterodimer). The Reagent Diluent recommended may be suitable for most cell culture supernate, serum, and plasma samples. The Reagent Diluent selected for use can alter the performance of an immunoassay. Reagent Diluent optimization for samples with complex matrices such as serum and plasma, may improve their performance in this assay. This kit contains sufficient materials to run ELISAs on at least five 96 well plates, provided the following conditions are met: • The reagents are prepared as described in this package insert. • The assay is run as described in the General ELISA Protocol. • The recommended microplates, buffers, diluents, substrates, and solutions are used. This package insert must be read in its entirety before using this product. Refer to the Certificate of Analysis for component concentrations as they may vary. For research use only. Not for use in diagnostic procedures.

Description: A sandwich ELISA kit for quantitative measurement of Human EED (Embryonic Ectoderm Development) in samples from Serum, Plasma, Cell supernatant

Description: A Rabbit polyclonal antibody against Human Embryonic Ectoderm Development (EED)

Description: A sandwich ELISA for quantitative measurement of Mouse Craniofacial development protein 1(CFDP1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Description: A sandwich ELISA for quantitative measurement of Mouse Craniofacial development protein 1(CFDP1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Description: A sandwich ELISA for quantitative measurement of Mouse Craniofacial development protein 1(CFDP1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Description: A Rabbit polyclonal antibody against Human Embryonic Ectoderm Development (EED). This antibody is labeled with APC.

Description: A Rabbit polyclonal antibody against Human Embryonic Ectoderm Development (EED). This antibody is labeled with Cy3.

Description: A Rabbit polyclonal antibody against Human Embryonic Ectoderm Development (EED). This antibody is labeled with HRP.