Limb Bud And Heart Development (LBH) Antibody |
20-abx333796 |
Abbexa |
-
EUR 493.20
-
EUR 2214.00
-
EUR 718.80
-
EUR 218.40
-
EUR 360.00
|
- 100 ug
- 1 mg
- 200 ug
- 20 ug
- 50 ug
|
|
Human IgG antibody Laboratories manufactures the commercial costs for mouse monoclonal antibody development reagents distributed by Genprice. The Commercial Costs For Mouse Monoclonal Antibody Development reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact mouse monoclonal. Other Commercial products are available in stock. Specificity: Commercial Category: Costs Group: For Mouse
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 564 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 474 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 495.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
For Mouse information
Mouse Embryonic Ectoderm Development (EED) ELISA Kit |
abx352684-96tests |
Abbexa |
96 tests |
EUR 943.2 |
|
ELISA kit for Rat EED (Embryonic Ectoderm Development) |
E-EL-R0360 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 640.8 |
|
Description: A sandwich ELISA kit for quantitative measurement of Rat EED (Embryonic Ectoderm Development) in samples from Serum, Plasma, Cell supernatant |
Limb Development Membrane Protein 1 Like (LMBR1L) Antibody |
abx234804-100ug |
Abbexa |
100 ug |
EUR 610.8 |
|
Limb Development Membrane Protein 1 Like (LMBR1L) Antibody |
20-abx113511 |
Abbexa |
|
|
|
H1N1 HA ELISA development kit |
DEIA533Cal |
Creative Diagnostics |
5 plates |
EUR 1051.2 |
Description: _The Influenza A H1N1 HA ELISA development kit is for the quantitative determination of Influenza A H1N1 (A/California/04/2009) Hemagglutinin. _This ELISA Pair Set contains the basic components required for the development of sandwich ELISAs. |
Mouse S100A8/S100A9 Heterodimer ELISA development kit |
DEIABL64 |
Creative Diagnostics |
96T |
EUR 889.2 |
Description: For the development of sandwich ELISAs to measure natural and recombinant mouse S100 Calcium Binding Protein A8 and S100 Calcium Binding Protein A9 Heterodimer (S100A8/S100A9 Heterodimer). The Reagent Diluent recommended may be suitable for most cell culture supernate, serum, and plasma samples. The Reagent Diluent selected for use can alter the performance of an immunoassay. Reagent Diluent optimization for samples with complex matrices such as serum and plasma, may improve their performance in this assay. This kit contains sufficient materials to run ELISAs on at least five 96 well plates, provided the following conditions are met: • The reagents are prepared as described in this package insert. • The assay is run as described in the General ELISA Protocol. • The recommended microplates, buffers, diluents, substrates, and solutions are used. This package insert must be read in its entirety before using this product. Refer to the Certificate of Analysis for component concentrations as they may vary. For research use only. Not for use in diagnostic procedures. |
ELISA kit for Human EED (Embryonic Ectoderm Development) |
E-EL-H1800 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 640.8 |
|
Description: A sandwich ELISA kit for quantitative measurement of Human EED (Embryonic Ectoderm Development) in samples from Serum, Plasma, Cell supernatant |
Embryonic Ectoderm Development (EED) Polyclonal Antibody (Human) |
4-PAC212Hu01 |
Cloud-Clone |
-
EUR 296.40
-
EUR 3012.00
-
EUR 750.00
-
EUR 372.00
-
EUR 256.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Human Embryonic Ectoderm Development (EED) |
Mouse Mesoderm development candidate 1, Mesdc1 ELISA KIT |
ELI-36441m |
Lifescience Market |
96 Tests |
EUR 1038 |
Mouse Craniofacial Development Protein 1 (CFDP1) ELISA Kit |
abx388924-96tests |
Abbexa |
96 tests |
EUR 1093.2 |
|
Mouse Craniofacial development protein 1(CFDP1) ELISA kit |
E03C1631-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A sandwich ELISA for quantitative measurement of Mouse Craniofacial development protein 1(CFDP1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Craniofacial development protein 1(CFDP1) ELISA kit |
E03C1631-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A sandwich ELISA for quantitative measurement of Mouse Craniofacial development protein 1(CFDP1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Craniofacial development protein 1(CFDP1) ELISA kit |
E03C1631-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A sandwich ELISA for quantitative measurement of Mouse Craniofacial development protein 1(CFDP1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Craniofacial development protein 1, Cfdp1 ELISA KIT |
ELI-10533m |
Lifescience Market |
96 Tests |
EUR 1038 |
Embryonic Ectoderm Development (EED) Polyclonal Antibody (Human), APC |
4-PAC212Hu01-APC |
Cloud-Clone |
-
EUR 414.00
-
EUR 3930.00
-
EUR 1094.40
-
EUR 528.00
-
EUR 262.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Human Embryonic Ectoderm Development (EED). This antibody is labeled with APC. |
Embryonic Ectoderm Development (EED) Polyclonal Antibody (Human), Cy3 |
4-PAC212Hu01-Cy3 |
Cloud-Clone |
-
EUR 502.80
-
EUR 5190.00
-
EUR 1410.00
-
EUR 654.00
-
EUR 301.20
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Human Embryonic Ectoderm Development (EED). This antibody is labeled with Cy3. |
Embryonic Ectoderm Development (EED) Polyclonal Antibody (Human), HRP |
4-PAC212Hu01-HRP |
Cloud-Clone |
-
EUR 379.20
-
EUR 3426.00
-
EUR 968.40
-
EUR 477.60
-
EUR 247.20
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Human Embryonic Ectoderm Development (EED). This antibody is labeled with HRP. |