Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Hamster Monoclonal Laboratories manufactures the hamster ovaries for monoclonal reagents distributed by Genprice. The Hamster Ovaries For Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact hamster monoclonal. Other Hamster products are available in stock. Specificity: Hamster Category: Ovaries Group: For Monoclonal

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 472.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594.

For Monoclonal information

Hamster Anti Mouse Cd154 Monoclonal Antibody,RPE

CABT-47159HM 100 TEST
EUR 639.6

Hamster Anti Mouse Cd178 Monoclonal Antibody,RPE

CABT-47223HM 100 TEST
EUR 639.6

Hamster Anti Mouse Cd28 Monoclonal Antibody,FITC

CABT-48078HM 0.1 mg
EUR 546

Hamster Anti Mouse Cd81 Monoclonal Antibody,FITC

CABT-48266HM 0.1 mg
EUR 546

Hamster Anti Human Emr3 Monoclonal Antibody,FITC

CABT-52284HH 0.1 mg
EUR 852

Hamster Anti Mouse Cd79b Monoclonal Antibody,RPE

CABT-54574HM 100 TEST
EUR 639.6

Hamster Anti Mouse Cd11c Monoclonal Antibody,FITC

CABT-45503HM 25 µg
EUR 483.6

Hamster Anti Mouse Cd49e Monoclonal Antibody,FITC

CABT-46396HM 0.1 mg
EUR 546

Hamster Anti Mouse Cd154 Monoclonal Antibody,FITC

CABT-47154HM 0.1 mg
EUR 546

Hamster Anti Mouse Cd178 Monoclonal Antibody,FITC

CABT-47217HM 0.1 mg
EUR 546

Hamster Anti Mouse Bim Monoclonal Antibody,Biotin

CABT-50129HM 0.1 mg
EUR 889.2

Hamster Anti Mouse Cd29 Monoclonal Antibody,Biotin

CABT-45867HM 0.1 mg
EUR 514.8

Hamster Anti Mouse Cd28 Monoclonal Antibody,Biotin

CABT-48075HM 0.1 mg
EUR 514.8

Hamster Anti Mouse Cd81 Monoclonal Antibody,Biotin

CABT-48264HM 0.1 mg
EUR 514.8

Hamster Anti Mouse Cd49e Monoclonal Antibody,Biotin

CABT-46394HM 0.1 mg
EUR 514.8

Hamster Anti Mouse Cd3 Monoclonal Antibody,RPE-Cy5

CABT-50515HM 0.5ml
EUR 889.2

Hamster Anti Mouse Cd69 Monoclonal Antibody,RPE-Cy5

CABT-46637HM 100 TEST
EUR 920.4