Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Hamster Monoclonal Laboratories manufactures the hamster ovaries for monoclonal reagents distributed by Genprice. The Hamster Ovaries For Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact hamster monoclonal. Other Hamster products are available in stock. Specificity: Hamster Category: Ovaries Group: For Monoclonal

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 472.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594.

For Monoclonal information

Armenian Hamster monoclonal CD29 antibody

MBS5305510-5x01mg 5x0.1mg
EUR 1835

Armenian Hamster monoclonal CD40 antibody

MBS5305549-005mg 0.05mg
EUR 315

Armenian Hamster monoclonal CD40 antibody

MBS5305549-01mg 0.1mg
EUR 510

Armenian Hamster monoclonal CD40 antibody

MBS5305549-5x01mg 5x0.1mg
EUR 2140

Armenian Hamster monoclonal CD80 antibody

MBS5305635-005mg 0.05mg
EUR 365

Armenian Hamster monoclonal CD80 antibody

MBS5305635-01mg 0.1mg
EUR 505

Armenian Hamster monoclonal CD80 antibody

MBS5305635-5x01mg 5x0.1mg
EUR 2110

Armenian Hamster monoclonal IL1b antibody

MBS5306457-005mg 0.05mg
EUR 410

Armenian Hamster monoclonal IL1b antibody

MBS5306457-5x005mg 5x0.05mg
EUR 1685

Hamster Monoclonal anti-mouse Podoplanin

mAP-0062 100ug
EUR 250

Armenian Hamster monoclonal CD305 antibody

MBS5305523-005mg 0.05mg
EUR 305

Armenian Hamster monoclonal CD305 antibody

MBS5305523-01mg 0.1mg
EUR 425

Armenian Hamster monoclonal CD305 antibody

MBS5305523-5x01mg 5x0.1mg
EUR 1770

Armenian Hamster monoclonal CD49b antibody

MBS5305586-005mg 0.05mg
EUR 315

Armenian Hamster monoclonal CD49b antibody

MBS5305586-01mg 0.1mg
EUR 460

Armenian Hamster monoclonal CD49b antibody

MBS5305586-5x01mg 5x0.1mg
EUR 1915

Armenian Hamster monoclonal CD49e antibody

MBS5305588-005mg 0.05mg
EUR 410