Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Igg Antibody Laboratories manufactures the igg antibody for syphillis reagents distributed by Genprice. The Igg Antibody For Syphillis reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Igg products are available in stock. Specificity: Igg Category: Antibody Group: For Syphillis

True north Cryobox 15mLBlue

PK10
EUR 212.4

True north Cryobox 50mLNatural

PK10
EUR 210

True north Cryobox 50mLBlue

PK10
EUR 210

True north Cryobox1.5/2mLNatural

PK10
EUR 162

True north Cryobox1.5/2.0mLGreen

PK10
EUR 162

True north Cryobox 1.5/2.0mLBlue

PK10
EUR 100.8

True north Cryobox 1.5/2.0mLBlue

PK10
EUR 162

For Syphillis information

Treponema Pallidum (Syphilis) p15/p17/p47 Protein

abx061572-1mg 1 mg
EUR 927.6

Treponema pallidum (Syphilis) p15/p17/p47 Protein

abx061573-1mg 1 mg
EUR 927.6

Treponema pallidum (Syphilis) p17/p15/p42.5/p47 Protein

abx061574-3mg 3 mg
EUR 1713.6

Recombinant (E. coli) Treponema Pallidum 47 Kda antigen (Syphilis), purified

SPL1547-R-100 100 ug
EUR 343.2

Recombinant (E. coli) Treponema Pallidum antigen (Syphilis,15kDa), purified

SPL15-R 100 ug
EUR 270

Recombinant (E. coli) Treponema Pallidum (Syphilis, 17kDa), purified

SPL17-R 100 ug
EUR 270

Recombinant (E. coli) Treponema Pallidum (Syphilis, 47kDa), purified

SPL47-R 100 ug
EUR 270

DiagNano Recombinant Syphilis (17 kDa) Conjugated Gold Nanoparticles

ACG-RSY01 5 mL
EUR 1275.6

DiagNano Recombinant Syphilis (15 kDa) Conjugated Gold Nanoparticles

ACG-RSY02 5 mL
EUR 1275.6

DiagNano Recombinant Syphilis (47 kDa) Conjugated Gold Nanoparticles

ACG-RSY03 5 mL
EUR 1275.6

DiagNano Recombinant Syphilis Conjugated Gold Nanoparticles

ACG-RSY04 5 mL
EUR 1275.6

Treponema Pallidum, Treponemal Membrane Protein A (TmpA) (Syphilis) Protein

abx061571-1mg 1 mg
EUR 2030.4

ELISA kit for Pig Trichinella IgG antibody (TAb-IgG)

KTE80194-48T 48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Pig Trichinella IgG antibody (TAb-IgG) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Pig Trichinella IgG antibody (TAb-IgG)

KTE80194-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Pig Trichinella IgG antibody (TAb-IgG) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Pig Trichinella IgG antibody (TAb-IgG)

KTE80194-96T 96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Pig Trichinella IgG antibody (TAb-IgG) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Thyroglobulin IgG antibody (TAb-IgG)

KTE100960-48T 48T
EUR 398.4
Description: Quantitative sandwich ELISA for measuring Rat Thyroglobulin IgG antibody (TAb-IgG) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Thyroglobulin IgG antibody (TAb-IgG)

KTE100960-5platesof96wells 5 plates of 96 wells
EUR 2538
Description: Quantitative sandwich ELISA for measuring Rat Thyroglobulin IgG antibody (TAb-IgG) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.