Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Igg Antibody Laboratories manufactures the igg antibody for syphillis reagents distributed by Genprice. The Igg Antibody For Syphillis reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Igg products are available in stock. Specificity: Igg Category: Antibody Group: For Syphillis

JBS True Blue

300 ┬Ál
EUR 16
Description: JBS True Blue

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

True north Cryobox1.5/2mLNatural

PK10
EUR 129.6

True Blue Diaceturate Salt

100mg
EUR 15000
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

1mg Ask for price
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

5mg Ask for price
Description: 108321-12-6

Sheep True insulin ELISA kit

96T
EUR 700
Description: ELISA

For Syphillis information

Recombinant Syphilis antigen

E41H097 100ug
EUR 160

Syphilis Test Card

INV-1022 4.0mm (strip in a card) 25cards/box
EUR 0.24

Syphilis Test Strip

INV-1021 3.0mm(single pouch) 100pouches/box
EUR 0.13

Syphilis Rapid Test

ISY-N401 1 kit Ask for price

Syphilis Rapid Test

ISY-N402 1 kit Ask for price

Syphilis TmpA recombinant antigen

9004 100 ug
EUR 418.87
Description: This is Syphilis TmpA recombinant antigen for ELISA,WB.

Syphilis TpN17 recombinant antigen

9005 100 ug
EUR 418.87
Description: This is Syphilis TpN17 recombinant antigen for ELISA,WB.

Syphilis TpN47 recombinant antigen

9006 100 ug
EUR 418.87
Description: This is Syphilis TpN47 recombinant antigen for ELISA,WB.

Bioline HIV/Syphilis Duo

06FK30CE 20 tests/kit
EUR 288.2

Syphilis p15/p17/p47 Chimeric Antigen (Capture)

DAGF-012 1 mg
EUR 761.25
Description: Recombinant

Syphilis TpN17 Protein

abx169035-1mg 1 mg
EUR 526.8

Syphilis TpN47 Protein

abx169036-1mg 1 mg
EUR 661.2

Syphilis p15/p17/p47 Chimeric Antigen (Detection)

DAGF-013 1 mg
EUR 761.25
Description: Recombinant

Syphilis Mixed Titer Panel (15 X 1mL)

KZMC002 15 X 1mL
EUR 760

Syphilis Rapid Test Cassette

ISY-402 40 Tests
EUR 6

Treponema pallidum (Syphilis) IgM

DE4267 96
EUR 98

Treponema Pallidum (Syphilis) Ab test

06FK10 30 tests/kit
EUR 50.05