Monoclonal antibody for SUR1 and SUR2B |
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Igg Antibody Laboratories manufactures the igg antibody for syphillis reagents distributed by Genprice. The Igg Antibody For Syphillis reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Igg products are available in stock. Specificity: Igg Category: Antibody Group: For Syphillis
JBS True Blue |
MiTeGen |
300 µl |
EUR 16 |
Description: JBS True Blue |
Sheep True insulin ELISA kit |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
For Syphillis information
Recombinant Syphilis antigen |
E41H097 |
EnoGene |
100ug |
EUR 160 |
Syphilis Test Card |
INV-1022 |
Innovation Biotech |
4.0mm (strip in a card) 25cards/box |
EUR 0.24 |
Syphilis Test Strip |
INV-1021 |
Innovation Biotech |
3.0mm(single pouch) 100pouches/box |
EUR 0.13 |
Syphilis TmpA recombinant antigen |
9004 |
Virostat |
100 ug |
EUR 418.87 |
Description: This is Syphilis TmpA recombinant antigen for ELISA,WB. |
Syphilis TpN17 recombinant antigen |
9005 |
Virostat |
100 ug |
EUR 418.87 |
Description: This is Syphilis TpN17 recombinant antigen for ELISA,WB. |
Syphilis TpN47 recombinant antigen |
9006 |
Virostat |
100 ug |
EUR 418.87 |
Description: This is Syphilis TpN47 recombinant antigen for ELISA,WB. |
Bioline HIV/Syphilis Duo |
06FK30CE |
Abbott |
20 tests/kit |
EUR 288.2 |
Syphilis p15/p17/p47 Chimeric Antigen (Capture) |
DAGF-012 |
Creative Diagnostics |
1 mg |
EUR 761.25 |
|
Description: Recombinant |
Syphilis TpN17 Protein |
abx169035-1mg |
Abbexa |
1 mg |
EUR 526.8 |
|
Syphilis TpN47 Protein |
abx169036-1mg |
Abbexa |
1 mg |
EUR 661.2 |
|
Syphilis p15/p17/p47 Chimeric Antigen (Detection) |
DAGF-013 |
Creative Diagnostics |
1 mg |
EUR 761.25 |
|
Description: Recombinant |
Syphilis Mixed Titer Panel (15 X 1mL) |
KZMC002 |
Zeptometrix |
15 X 1mL |
EUR 760 |
Treponema Pallidum (Syphilis) Ab test |
06FK10 |
Abbott |
30 tests/kit |
EUR 50.05 |