Monoclonal antibody for SUR1 and SUR2B |
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Igg Antibody Laboratories manufactures the igg antibody for syphillis reagents distributed by Genprice. The Igg Antibody For Syphillis reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Igg products are available in stock. Specificity: Igg Category: Antibody Group: For Syphillis
For Syphillis information
Treponema Pallidum (Syphilis) p15/p17/p47 Protein |
abx061572-1mg |
Abbexa |
1 mg |
EUR 927.6 |
|
Treponema pallidum (Syphilis) p15/p17/p47 Protein |
abx061573-1mg |
Abbexa |
1 mg |
EUR 927.6 |
|
Treponema pallidum (Syphilis) p17/p15/p42.5/p47 Protein |
abx061574-3mg |
Abbexa |
3 mg |
EUR 1713.6 |
|
Recombinant (E. coli) Treponema Pallidum 47 Kda antigen (Syphilis), purified |
SPL1547-R-100 |
Alpha Diagnostics |
100 ug |
EUR 343.2 |
Recombinant (E. coli) Treponema Pallidum antigen (Syphilis,15kDa), purified |
SPL15-R |
Alpha Diagnostics |
100 ug |
EUR 270 |
Recombinant (E. coli) Treponema Pallidum (Syphilis, 17kDa), purified |
SPL17-R |
Alpha Diagnostics |
100 ug |
EUR 270 |
Recombinant (E. coli) Treponema Pallidum (Syphilis, 47kDa), purified |
SPL47-R |
Alpha Diagnostics |
100 ug |
EUR 270 |
DiagNano Recombinant Syphilis (17 kDa) Conjugated Gold Nanoparticles |
ACG-RSY01 |
Creative Diagnostics |
5 mL |
EUR 1275.6 |
DiagNano Recombinant Syphilis (15 kDa) Conjugated Gold Nanoparticles |
ACG-RSY02 |
Creative Diagnostics |
5 mL |
EUR 1275.6 |
DiagNano Recombinant Syphilis (47 kDa) Conjugated Gold Nanoparticles |
ACG-RSY03 |
Creative Diagnostics |
5 mL |
EUR 1275.6 |
DiagNano Recombinant Syphilis Conjugated Gold Nanoparticles |
ACG-RSY04 |
Creative Diagnostics |
5 mL |
EUR 1275.6 |
Treponema Pallidum, Treponemal Membrane Protein A (TmpA) (Syphilis) Protein |
abx061571-1mg |
Abbexa |
1 mg |
EUR 2030.4 |
|
ELISA kit for Pig Trichinella IgG antibody (TAb-IgG) |
KTE80194-48T |
Abbkine |
48T |
EUR 424.8 |
|
Description: Quantitative sandwich ELISA for measuring Pig Trichinella IgG antibody (TAb-IgG) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Pig Trichinella IgG antibody (TAb-IgG) |
KTE80194-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2702.4 |
|
Description: Quantitative sandwich ELISA for measuring Pig Trichinella IgG antibody (TAb-IgG) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Pig Trichinella IgG antibody (TAb-IgG) |
KTE80194-96T |
Abbkine |
96T |
EUR 686.4 |
|
Description: Quantitative sandwich ELISA for measuring Pig Trichinella IgG antibody (TAb-IgG) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Rat Thyroglobulin IgG antibody (TAb-IgG) |
KTE100960-48T |
Abbkine |
48T |
EUR 398.4 |
|
Description: Quantitative sandwich ELISA for measuring Rat Thyroglobulin IgG antibody (TAb-IgG) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Rat Thyroglobulin IgG antibody (TAb-IgG) |
KTE100960-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2538 |
|
Description: Quantitative sandwich ELISA for measuring Rat Thyroglobulin IgG antibody (TAb-IgG) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |