Human IgG Mouse Monoclonal Antibody

E10G20464 100 μl
EUR 275
Description: Biotin-Conjugated, FITC-Conjugated , AF350 Conjugated , AF405M-Conjugated ,AF488-Conjugated, AF514-Conjugated ,AF532-Conjugated, AF555-Conjugated ,AF568-Conjugated , HRP-Conjugated, AF405S-Conjugated, AF405L-Conjugated , AF546-Conjugated, AF594-Conjugated , AF610-Conjugated, AF635-Conjugated , AF647-Conjugated , AF680-Conjugated , AF700-Conjugated , AF750-Conjugated , AF790-Conjugated , APC-Conjugated , PE-Conjugated , Cy3-Conjugated , Cy5-Conjugated , Cy5.5-Conjugated , Cy7-Conjugated Antibody

Human IgG antibody Laboratories manufactures the secondary antibody for mouse monoclonal reagents distributed by Genprice. The Secondary Antibody For Mouse Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact mouse Antibody. Other Secondary products are available in stock. Specificity: Secondary Category: Antibody Group: For Mouse

Bridging Antibody for Mouse IgG

5x0.5mg
EUR 860

Mouse Anti Human Igg Monoclonal Antibody

1 mg
EUR 889.2

Mouse Monoclonal Antibody to human IgG

50ug
EUR 270

Mouse anti-human IgG monoclonal antibody

1mg
EUR 265

Mouse anti-human IgG monoclonal antibody

5x1mg
EUR 1035

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

For Mouse information

Biotin Conjugated Mouse Anti-human IgG secondary antibody

MBS176705-05mL 0.5mL
EUR 190

Biotin Conjugated Mouse Anti-human IgG secondary antibody

MBS176705-5x05mL 5x0.5mL
EUR 710

Biotin Conjugated Mouse Anti-rabbit IgG secondary antibody

MBS176664-05mL 0.5mL
EUR 190

Biotin Conjugated Mouse Anti-rabbit IgG secondary antibody

MBS176664-5x05mL 5x0.5mL
EUR 710

STAT-Q anti Mouse Secondary Linking antibody (Seco

NB314KM-20 15 ml
EUR 295
Description: STAT-Q anti Mouse Secondary Linking antibody (Secondary Reagent kit-Component) Ready-To-Use for staining Mouse antibodies, 250 plus slides

Goat Anti-Mouse IgG Secondary Antibody

TA130001 1 mg Ask for price

Anti-Mouse Ig:DyLight 488 Secondary Antibody

MBS474460-05mL 0.5mL
EUR 255

Anti-Mouse Ig:DyLight 488 Secondary Antibody

MBS474460-5x05mL 5x0.5mL
EUR 995

Anti-Mouse Ig:DyLight 594 Secondary Antibody

MBS474461-05mL 0.5mL
EUR 255

Anti-Mouse Ig:DyLight 594 Secondary Antibody

MBS474461-5x05mL 5x0.5mL
EUR 995

Anti-Mouse Ig:DyLight 650 Secondary Antibody

MBS474462-05mL 0.5mL
EUR 255

Anti-Mouse Ig:DyLight 650 Secondary Antibody

MBS474462-5x05mL 5x0.5mL
EUR 995

CLIA kit for Mouse SLC (Secondary Lymphoid Tissue Chemokine)

E-CL-M0107 1 plate of 96 wells
EUR 700.8
Description: A sandwich CLIA kit for quantitative measurement of Mouse SLC (Secondary Lymphoid Tissue Chemokine) in samples from Serum, Plasma, Cell supernatant

poly-HRP conjugated Mouse anti-human IgM Secondary Antibody

MBS7608347-01mL 0.1mL
EUR 160

poly-HRP conjugated Mouse anti-human IgM Secondary Antibody

MBS7608347-5x01mL 5x0.1mL
EUR 710

poly-HRP conjugated Mouse anti-human IgG Secondary Antibody

MBS7608348-01mL 0.1mL
EUR 160

poly-HRP conjugated Mouse anti-human IgG Secondary Antibody

MBS7608348-5x01mL 5x0.1mL
EUR 710