Human IgG Mouse Monoclonal Antibody |
E10G20464 |
EnoGene |
100 μl |
EUR 275 |
Description: Biotin-Conjugated, FITC-Conjugated , AF350 Conjugated , AF405M-Conjugated ,AF488-Conjugated, AF514-Conjugated ,AF532-Conjugated, AF555-Conjugated ,AF568-Conjugated , HRP-Conjugated, AF405S-Conjugated, AF405L-Conjugated , AF546-Conjugated, AF594-Conjugated , AF610-Conjugated, AF635-Conjugated , AF647-Conjugated , AF680-Conjugated , AF700-Conjugated , AF750-Conjugated , AF790-Conjugated , APC-Conjugated , PE-Conjugated , Cy3-Conjugated , Cy5-Conjugated , Cy5.5-Conjugated , Cy7-Conjugated Antibody |
Human IgG antibody Laboratories manufactures the secondary antibody for mouse monoclonal reagents distributed by Genprice. The Secondary Antibody For Mouse Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact mouse Antibody. Other Secondary products are available in stock. Specificity: Secondary Category: Antibody Group: For Mouse
Bridging Antibody for Mouse IgG |
MyBiosource |
5x0.5mg |
EUR 860 |
Mouse anti-human IgG monoclonal antibody |
MyBiosource |
1mg |
EUR 265 |
Mouse anti-human IgG monoclonal antibody |
MyBiosource |
5x1mg |
EUR 1035 |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 480 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
For Mouse information
Biotin Conjugated Mouse Anti-human IgG secondary antibody |
MBS176705-05mL |
MyBiosource |
0.5mL |
EUR 190 |
Biotin Conjugated Mouse Anti-human IgG secondary antibody |
MBS176705-5x05mL |
MyBiosource |
5x0.5mL |
EUR 710 |
Biotin Conjugated Mouse Anti-rabbit IgG secondary antibody |
MBS176664-05mL |
MyBiosource |
0.5mL |
EUR 190 |
Biotin Conjugated Mouse Anti-rabbit IgG secondary antibody |
MBS176664-5x05mL |
MyBiosource |
5x0.5mL |
EUR 710 |
STAT-Q anti Mouse Secondary Linking antibody (Seco |
NB314KM-20 |
Innovex |
15 ml |
EUR 295 |
Description: STAT-Q anti Mouse Secondary Linking antibody (Secondary Reagent kit-Component) Ready-To-Use for staining Mouse antibodies, 250 plus slides |
Anti-Mouse Ig:DyLight 488 Secondary Antibody |
MBS474460-05mL |
MyBiosource |
0.5mL |
EUR 255 |
Anti-Mouse Ig:DyLight 488 Secondary Antibody |
MBS474460-5x05mL |
MyBiosource |
5x0.5mL |
EUR 995 |
Anti-Mouse Ig:DyLight 594 Secondary Antibody |
MBS474461-05mL |
MyBiosource |
0.5mL |
EUR 255 |
Anti-Mouse Ig:DyLight 594 Secondary Antibody |
MBS474461-5x05mL |
MyBiosource |
5x0.5mL |
EUR 995 |
Anti-Mouse Ig:DyLight 650 Secondary Antibody |
MBS474462-05mL |
MyBiosource |
0.5mL |
EUR 255 |
Anti-Mouse Ig:DyLight 650 Secondary Antibody |
MBS474462-5x05mL |
MyBiosource |
5x0.5mL |
EUR 995 |
CLIA kit for Mouse SLC (Secondary Lymphoid Tissue Chemokine) |
E-CL-M0107 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 700.8 |
|
Description: A sandwich CLIA kit for quantitative measurement of Mouse SLC (Secondary Lymphoid Tissue Chemokine) in samples from Serum, Plasma, Cell supernatant |
poly-HRP conjugated Mouse anti-human IgM Secondary Antibody |
MBS7608347-01mL |
MyBiosource |
0.1mL |
EUR 160 |
poly-HRP conjugated Mouse anti-human IgM Secondary Antibody |
MBS7608347-5x01mL |
MyBiosource |
5x0.1mL |
EUR 710 |
poly-HRP conjugated Mouse anti-human IgG Secondary Antibody |
MBS7608348-01mL |
MyBiosource |
0.1mL |
EUR 160 |
poly-HRP conjugated Mouse anti-human IgG Secondary Antibody |
MBS7608348-5x01mL |
MyBiosource |
5x0.1mL |
EUR 710 |