Human IgG Mouse Monoclonal Antibody
E10G20464 100 μl
EUR 275
Description: Biotin-Conjugated, FITC-Conjugated , AF350 Conjugated , AF405M-Conjugated ,AF488-Conjugated, AF514-Conjugated ,AF532-Conjugated, AF555-Conjugated ,AF568-Conjugated , HRP-Conjugated, AF405S-Conjugated, AF405L-Conjugated , AF546-Conjugated, AF594-Conjugated , AF610-Conjugated, AF635-Conjugated , AF647-Conjugated , AF680-Conjugated , AF700-Conjugated , AF750-Conjugated , AF790-Conjugated , APC-Conjugated , PE-Conjugated , Cy3-Conjugated , Cy5-Conjugated , Cy5.5-Conjugated , Cy7-Conjugated Antibody

Human IgG antibody Laboratories manufactures the secondary antibody for mouse monoclonal reagents distributed by Genprice. The Secondary Antibody For Mouse Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact mouse Antibody. Other Secondary products are available in stock. Specificity: Secondary Category: Antibody Group: For Mouse

Bridging Antibody for Mouse IgG
5x0.5mg
EUR 860

Mouse Anti Human Igg Monoclonal Antibody
1 mg
EUR 546
Description: Mouse

Mouse anti-human IgG monoclonal antibody
1mg
EUR 265

Mouse anti-human IgG monoclonal antibody
5x1mg
EUR 1035

Mouse Monoclonal Antibody to human IgG
50ug
EUR 270

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

For Mouse information

Mouse secondary antibody to human IgG (Fc)-Unconjugated
MBS355657-5x1mg 5x1mg
EUR 1080

Anti-Mouse Ig:HRP Secondary Antibody
MBS474459-01mL 0.1mL
EUR 190

Anti-Mouse Ig:HRP Secondary Antibody
MBS474459-5x01mL 5x0.1mL
EUR 700

Biotin Conjugated Mouse Anti-human IgG secondary antibody
MBS176705-05mL 0.5mL
EUR 190

Biotin Conjugated Mouse Anti-human IgG secondary antibody
MBS176705-5x05mL 5x0.5mL
EUR 710

Biotin Conjugated Mouse Anti-rabbit IgG secondary antibody
MBS176664-05mL 0.5mL
EUR 190

Biotin Conjugated Mouse Anti-rabbit IgG secondary antibody
MBS176664-5x05mL 5x0.5mL
EUR 710

Goat Anti-Mouse IgG Secondary Antibody
TA130001 1 mg Ask for price

Anti-Mouse Ig:DyLight 488 Secondary Antibody
MBS474460-05mL 0.5mL
EUR 255

Anti-Mouse Ig:DyLight 488 Secondary Antibody
MBS474460-5x05mL 5x0.5mL
EUR 995

Anti-Mouse Ig:DyLight 594 Secondary Antibody
MBS474461-05mL 0.5mL
EUR 255

Anti-Mouse Ig:DyLight 594 Secondary Antibody
MBS474461-5x05mL 5x0.5mL
EUR 995

Anti-Mouse Ig:DyLight 650 Secondary Antibody
MBS474462-05mL 0.5mL
EUR 255

Anti-Mouse Ig:DyLight 650 Secondary Antibody
MBS474462-5x05mL 5x0.5mL
EUR 995

STAT-Q anti Mouse, Rat Adsorbed Secondary Linking antibody (Secondary Reagent kit-Component) for staining Mouse antibodies-on-Rat tissues, Ready-To-Use 250 plus slides
NB318MR-20 15 ml
EUR 375

poly-HRP conjugated Mouse anti-human IgM Secondary Antibody
MBS7608347-01mL 0.1mL
EUR 160

poly-HRP conjugated Mouse anti-human IgM Secondary Antibody
MBS7608347-5x01mL 5x0.1mL
EUR 710