Human IgG antibody Laboratories manufactures the secondary antibody for mouse monoclonal reagents distributed by Genprice. The Secondary Antibody For Mouse Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact mouse Antibody. Other Secondary products are available in stock. Specificity: Secondary Category: Antibody Group: For Mouse
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 564 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 474 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 495.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 482.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 470.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
For Mouse information
Goat Anti-Mouse IgG Secondary Antibody APC Conjugated |
L30316 |
SAB |
0.5 ml |
EUR 229.2 |
Goat Anti-Mouse IgG Secondary Antibody HRP Conjugated |
L3032 |
SAB |
1.0 ml |
EUR 134.4 |
Goat Anti-Mouse IgG Secondary Antibody FITC Conjugated |
L30313 |
SAB |
1.0 ml |
EUR 116.4 |
Goat Anti-Mouse IgG Secondary Antibody AMCA Conjugated |
L3035 |
SAB |
1.0 ml |
EUR 116.4 |
Goat Anti-Mouse IgG Secondary Antibody AF790 Conjugated |
L30310 |
SAB |
0.5 ml |
EUR 151.2 |
Goat Anti-Mouse IgG Secondary Antibody PerCP Conjugated |
L30318 |
SAB |
0.5 ml |
EUR 229.2 |
Goat Anti-Mouse IgG Secondary Antibody AF488 Conjugated |
L3036 |
SAB |
1.0 ml |
EUR 134.4 |
Goat Anti-Mouse IgG Secondary Antibody AF594 Conjugated |
L3037 |
SAB |
1.0 ml |
EUR 134.4 |
Goat Anti-Mouse IgG Secondary Antibody AF647 Conjugated |
L3038 |
SAB |
1.0 ml |
EUR 134.4 |
Goat Anti-Mouse IgG Secondary Antibody AF680 Conjugated |
L3039 |
SAB |
0.5 ml |
EUR 151.2 |
Biotin Conjugated Goat Anti-mouse IgM secondary antibody |
BA1004-0.25 |
BosterBio |
0.25ml |
EUR 279.6 |
Biotin Conjugated Goat Anti-mouse IgM secondary antibody |
BA1004-0.5 |
BosterBio |
0.5ml |
EUR 486 |
Goat Anti-Mouse IgG Secondary Antibody Biotin Conjugated |
L3034 |
SAB |
1.0 ml |
EUR 124.8 |
Secondary Lymphoid Tissue Chemokine (SLC) Polyclonal Antibody (Mouse) |
4-PAB575Mu01 |
Cloud-Clone |
-
EUR 291.60
-
EUR 2948.40
-
EUR 735.60
-
EUR 366.00
-
EUR 254.40
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Mouse Secondary Lymphoid Tissue Chemokine (SLC) |
unconjugated Goat Anti-mouse IgG (H+L) secondary antibody |
BA1038-1 |
BosterBio |
1mg |
EUR 121.2 |
unconjugated Goat Anti-mouse IgG (H+L) secondary antibody |
BA1038-5 |
BosterBio |
5mg |
EUR 279.6 |
unconjugated Rabbit Anti-mouse IgG (H+L) secondary antibody |
BA1048-1 |
BosterBio |
1mg |
EUR 121.2 |